PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0403s0220.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 343aa    MW: 38010.9 Da    PI: 6.8367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0403s0220.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.2e-191461148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT+eEd++lv++++++G g+W++ ++  g++R++k+c++rw +yl
  SapurV1A.0403s0220.1.p 14 KGPWTPEEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                            79********************************************97 PP

2Myb_DNA-binding54.82.1e-1767112148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  SapurV1A.0403s0220.1.p  67 RGKFSQEEEQTILNLHSILGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 112
                             89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.129961IPR017930Myb domain
SuperFamilySSF466891.1E-3211108IPR009057Homeodomain-like
SMARTSM007172.4E-161363IPR001005SANT/Myb domain
PfamPF002492.0E-181461IPR001005SANT/Myb domain
CDDcd001673.05E-131661No hitNo description
PROSITE profilePS5129426.44262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002496.2E-1667112IPR001005SANT/Myb domain
CDDcd001673.25E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLVKYIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIAGHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLI ALANLKELMD HHSLEEHALR MQTEAAQMAK LQYLQYLLQP  180
QPPAASSNAT SSNNLNNIST IGEMESFNLL NSLPSFKDSP VSTLSQLDLS ASSLQGVNDL  240
ISFSHLPDLQ IPCNYQTPAN KEVLDQAPDQ LTVFSQGENS PNSPWQLPSS STPSPPSVFP  300
PVTQNCGMIH NLGDASSTSS YAGEAPSVWH DILENPLFND IA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307080.20.0hypothetical protein POPTR_0005s07590g
RefseqXP_011031021.10.0PREDICTED: myb-related protein 308-like
SwissprotQ8GWP07e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLB9H4T10.0B9H4T1_POPTR; Uncharacterized protein
STRINGPOPTR_0005s07590.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-97myb domain protein 93